Names & Taxonomy

Uniprot ID:
K7ELS8
Entry Name:
K7ELS8_HUMAN
Status:
unreviewed
Protein Names:
Synaptogyrin-2 (Fragment)
Gene Names:
SYNGR2
Gene Names Primary:
SYNGR2
Organism:
Homo sapiens (Human)

Structure

Length:
135
Sequence:
XESGAYGAAKAGGSFDLRRFLTQPQVVARAVCLVFALIVFSCIYGEGYSNAHESKQMYCVFNRNEDACRYGSAIGVLAFLASAFFLVVDAYFPQISNATDRKYLVIGDLLFSGCAGLPGLPALQGWRGRLHPELR
Proteomes:
UP000005640

Function

Gene Ontology Go:
integral component of membrane
Gene Ontology Cellular Component:
integral component of membrane
Keywords:
Complete proteome
Membrane
Proteomics identification
Reference proteome
Transmembrane
Transmembrane helix

Publication

PubMed ID:
16625196 21269460