Names & Taxonomy

Uniprot ID:
J9Z5V2
Entry Name:
J9Z5V2_HUMAN
Status:
unreviewed
Protein Names:
MHC II antigen (Fragment)
Gene Names:
HLA-DQB1
Gene Names Primary:
HLA-DQB1
Organism:
Homo sapiens (Human)

Structure

Length:
186
Sequence:
DFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQTPQRGDVYTCHVEHPSLQNPIIVEW

Function

Gene Ontology Go:
integral component of membrane
MHC class II protein complex
antigen processing and presentation of peptide or polysaccharide antigen via MHC class II
immune response
Gene Ontology Biological Process:
antigen processing and presentation of peptide or polysaccharide antigen via MHC class II
immune response
Gene Ontology Cellular Component:
integral component of membrane
MHC class II protein complex
Keywords:
Disulfide bond
Immunity
MHC II
Membrane
Transmembrane
Transmembrane helix