Names & Taxonomy

Uniprot ID:
J7HDW9
Entry Name:
J7HDW9_HUMAN
Status:
unreviewed
Protein Names:
MHC class I antigen (Fragment)
Gene Names:
HLA-A
Gene Names Primary:
HLA-A
Organism:
Homo sapiens (Human)

Structure

Length:
273
Sequence:
SHSMRCFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW

Function

Gene Ontology Go:
MHC class I protein complex
peptide antigen binding
antigen processing and presentation of peptide antigen via MHC class I
immune response
Gene Ontology Biological Process:
antigen processing and presentation of peptide antigen via MHC class I
immune response
Gene Ontology Molecular Function:
peptide antigen binding
Gene Ontology Cellular Component:
MHC class I protein complex