Names & Taxonomy

Uniprot ID:
H9M4B7
Entry Name:
H9M4B7_HUMAN
Status:
unreviewed
Protein Names:
Cytochrome c oxidase subunit 1 (EC 1.9.3.1)
Gene Names:
COX1
Gene Names Primary:
COX1
Organism:
Homo sapiens (Human)

Structure

Length:
513
Sequence:
MFADRWLFSTNHKDIGTLYLLFGAWAGVLGTALSLLIRAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGSNMKWSAAVLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFIHWFPLFSGYTLDQTYAKIHFAIMFIGVNLTFFPQHFLGLSGMPRRYSDYPDAYTTWNILSSVGSFISLTAVMLMIFMIWEAFASKRKVLMVEEPSMNLEWLHGCPPPYHTFEEPVYMKS

Subcellular location

Subcellular Location:
Mitochondrion inner membrane
Gene Encoded:
Mitochondrion

Function

Function:
Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.
Pathway:
Energy metabolism; oxidative phosphorylation.
Catalytic Activity:
4 ferrocytochrome c + O(2) + 4 H(+) = 4 ferricytochrome c + 2 H(2)O.
Gene Ontology Go:
integral component of membrane
mitochondrial inner membrane
respiratory chain
cytochrome-c oxidase activity
heme binding
iron ion binding
aerobic respiration
oxidative phosphorylation
Gene Ontology Biological Process:
aerobic respiration
oxidative phosphorylation
Gene Ontology Molecular Function:
cytochrome-c oxidase activity
heme binding
iron ion binding
Gene Ontology Cellular Component:
integral component of membrane
mitochondrial inner membrane
respiratory chain
Keywords:
Copper
Electron transport
Heme
Iron
Membrane
Metal-binding
Mitochondrion
Mitochondrion inner membrane
Oxidoreductase
Respiratory chain
Transmembrane
Transmembrane helix
Transport

Publication

PubMed ID:
22454235