Names & Taxonomy

Uniprot ID:
H7C2Z6
Entry Name:
H7C2Z6_HUMAN
Status:
unreviewed
Protein Names:
Grancalcin (Fragment)
Gene Names:
GCA
Gene Names Primary:
GCA
Organism:
Homo sapiens (Human)

Structure

Length:
146
Sequence:
XFSLETCRIMIAMLDRDHTGKMGFNAFKELWAALNAWKENFMTVDQDGSGTVEHHELRQAIGLMGYRLSPQTLTTIVKRYSKNGRIFFDDYVACCVKLRALTDFFRKRDHLQQGSANFIYDDCGGMNVINFEHLDTERPESVCKSD
Proteomes:
UP000005640

Function

Gene Ontology Go:
calcium ion binding
Gene Ontology Molecular Function:
calcium ion binding
Keywords:
Complete proteome
Proteomics identification
Reference proteome

Publication

PubMed ID:
15815621 21269460