Names & Taxonomy

Uniprot ID:
H7C139
Entry Name:
H7C139_HUMAN
Status:
unreviewed
Protein Names:
Stromelysin-1 (Fragment)
Gene Names:
MMP3
Gene Names Primary:
MMP3
Organism:
Homo sapiens (Human)

Structure

Length:
99
Sequence:
XNQFWAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAVFEEFDRAGTECCLHS
Proteomes:
UP000005640

Function

Gene Ontology Go:
metalloendopeptidase activity
Gene Ontology Molecular Function:
metalloendopeptidase activity
Keywords:
Complete proteome
Proteomics identification
Reference proteome

Publication

PubMed ID:
16554811