Names & Taxonomy

Uniprot ID:
H7C113
Entry Name:
H7C113_HUMAN
Status:
unreviewed
Protein Names:
Phospholipid-transporting ATPase IG (Fragment)
Gene Names:
ATP11C
Gene Names Primary:
ATP11C
Organism:
Homo sapiens (Human)

Structure

Length:
165
Sequence:
XEGTVFFFGTYFLFQTASLEENGKVYGNWTFGTIVFTVLVFTVTLKLALDTRFWTWINHFVIWGSLAFYVFFSFFWGGIIWPFLKQQRMYFVFAQMLSSVSTWLAIILLIFISLFPEILLIVLKNVRRRSARRNLSCRRASDSLSARPSVRPLLLRTFSDESNVL
Proteomes:
UP000005640

Function

Gene Ontology Go:
integral component of membrane
ATP binding
magnesium ion binding
phospholipid-translocating ATPase activity
Gene Ontology Molecular Function:
ATP binding
magnesium ion binding
phospholipid-translocating ATPase activity
Gene Ontology Cellular Component:
integral component of membrane
Keywords:
Complete proteome
Membrane
Proteomics identification
Reference proteome
Transmembrane
Transmembrane helix

Publication

PubMed ID:
15772651 18669648 20068231