Names & Taxonomy

Uniprot ID:
H7C045
Entry Name:
H7C045_HUMAN
Status:
unreviewed
Protein Names:
Rhomboid-like protein (EC 3.4.21.-) (Fragment)
Gene Names:
PARL
Gene Names Primary:
PARL
Organism:
Homo sapiens (Human)

Structure

Length:
112
Sequence:
XSIVNILGQEQFMAVYLSAGVISNFVSYVGKVATGRYGPSLGAALKAIIAMDTAGMILGWKFFDHAAHLGGALFGIWYVTYGHELIWKNREPLVKIWHEIRTNGPKKGGGSK
Proteomes:
UP000005640

Subcellular location

Subcellular Location:
Membrane

Function

Gene Ontology Go:
integral component of membrane
serine-type endopeptidase activity
Gene Ontology Molecular Function:
serine-type endopeptidase activity
Gene Ontology Cellular Component:
integral component of membrane
Keywords:
Complete proteome
Hydrolase
Membrane
Protease
Proteomics identification
Reference proteome
Transmembrane
Transmembrane helix

Publication

PubMed ID:
16641997