Names & Taxonomy

Uniprot ID:
H0YFC1
Entry Name:
H0YFC1_HUMAN
Status:
unreviewed
Protein Names:
Solute carrier family 15 member 3 (Fragment)
Gene Names:
SLC15A3
Gene Names Primary:
SLC15A3
Organism:
Homo sapiens (Human)

Structure

Length:
247
Sequence:
XPGASPQEDIANFQVLVKILPVMVTLVPYWMVYFQIPEAWLLLANVVVVLILVPLKDRLIDPLLLRCKLLPSALQKMALGMFFGFTSVIVAGVLEMERLHYIHHNETVSQQIGEVLYNAAPLSIWWQIPQYLLIGISEIFASIPGLEFAYSEAPRSMQGAIMGIFFCLSGVGSLLGSSLVALLSLPGGWLHCPKDFGNINNCRMDLYFFLLAGIQAVTALLFVWIAGRYERASQGPASHSRFSRDRG
Proteomes:
UP000005640

Function

Gene Ontology Go:
integral component of membrane
transporter activity
Gene Ontology Molecular Function:
transporter activity
Gene Ontology Cellular Component:
integral component of membrane
Keywords:
Complete proteome
Membrane
Proteomics identification
Reference proteome
Transmembrane
Transmembrane helix

Publication

PubMed ID:
16554811