Names & Taxonomy

Uniprot ID:
H0YBS7
Entry Name:
H0YBS7_HUMAN
Status:
unreviewed
Protein Names:
Gamma-aminobutyric acid receptor subunit alpha-6 (Fragment)
Gene Names:
GABRA6
Gene Names Primary:
GABRA6
Organism:
Homo sapiens (Human)

Structure

Length:
185
Sequence:
SRCSGDSVPGTDGCSIHKRVFIEYTMDVFFRQTWTDERLKFGGPTEILSLNNLMVSKIWTPDTFFRNGKKSIAHNMTTPNKLFRIMQNGTILYTMRLTINADCPMRLVNFPMDGHACPLKFGSYAYPKSEIIYTWKKGPLYSVEVPEESSSLLQYDLIGQTVSSETIKSNTGEYVIMTVYFHLQR
Proteomes:
UP000005640

Function

Gene Ontology Go:
integral component of membrane
extracellular ligand-gated ion channel activity
GABA-A receptor activity
Gene Ontology Molecular Function:
extracellular ligand-gated ion channel activity
GABA-A receptor activity
Gene Ontology Cellular Component:
integral component of membrane
Keywords:
Complete proteome
Ion channel
Ion transport
Membrane
Reference proteome
Transmembrane
Transmembrane helix
Transport

Publication

PubMed ID:
15372022