Names & Taxonomy
- Uniprot ID:
- F8WAH6
- Entry Name:
- F8WAH6_HUMAN
- Status:
- unreviewed
- Protein Names:
- Elastin
- Gene Names:
- ELN
- Gene Names Primary:
- ELN
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 786
- Sequence:
- MAGLTAAAPRPGVLLLLLSILHPSRPGGVPGAIPGGVPGGVFYPGAGLGALGGGALGPGGKPLKPVPGGLAGAGLGAGLGAFPAVTFPGALVPGGVADAAAAYKAAKAGAGLGGVPGVGGLGVSAGAVVPQPGAGVKPGKVPGVGLPGVYPGGVLPGARFPGVGVLPGVPTGAGVKPKAPGVGGAFAGIPGVGPFGGPQPGVPLGYPIKAPKLPGGYGLPYTTGKLPYGYGPGGVAGAAGKAGYPTGTGVGPQAAAAAAAKAAAKFGAGAAGVLPGVGGAGVPGVPGAIPGIGGIAGVGTPAAAAAAAAAAKAAKYGAAAGLVPGGPGFGPGVVGVPGAGVPGVGVPGAGIPVVPGAGIPGAAVPGVVSPEAAAKAAAKAAKYGARPGVGVGGIPTYGVGAGGFPGFGVGVGGIPGVAGVPGVGGVPGVGGVPGVGISPEAQAAAAAKAAKYGAAGAGVLGGLVPGAPGAVPGVPGTGGVPGVGTPAAAAAKAAAKAAQFGLVPGVGVAPGVGVAPGVGVAPGVGLAPGVGVAPGVGVAPGVGVAPGIGPGGVAAAAKSAAKVAAKAQLRAAAGLGAGIPGLGVGVGVPGLGVGAGVPGLGVGAGVPGFGAGADEGVRRSLSPELREGDPSSSQHLPSTPSSPRVPGALAAAKAAKYGAAVPGVLGGLGALGGVGIPGGVVGAGPAAAAAAAKAAAKAAQFGLVGAAGLGGLGVGGLGVPGVGGLGGIPPAAAAKAAKYGAAGLGGVLGGAGQFPLGGVAARPGFGLSPIFPGGACLGKACGRKRK
- Proteomes:
- UP000005640
Function
- Gene Ontology Go:
- elastic fiber
extracellular space
mitochondrion
proteinaceous extracellular matrix
extracellular matrix binding
extracellular matrix constituent conferring elasticity
aging
aorta development
blood vessel remodeling
cellular response to copper ion
cellular response to dexamethasone stimulus
cellular response to fibroblast growth factor stimulus
cellular response to hypoxia
cellular response to L-ascorbic acid
cellular response to retinoic acid
cellular response to transforming growth factor beta stimulus
extracellular matrix organization
regulation of actin filament polymerization
response to diuretic
response to hyperoxia
skeletal muscle tissue development
stress fiber assembly - Gene Ontology Biological Process:
- aging
aorta development
blood vessel remodeling
cellular response to copper ion
cellular response to dexamethasone stimulus
cellular response to fibroblast growth factor stimulus
cellular response to hypoxia
cellular response to L-ascorbic acid
cellular response to retinoic acid
cellular response to transforming growth factor beta stimulus
extracellular matrix organization
regulation of actin filament polymerization
response to diuretic
response to hyperoxia
skeletal muscle tissue development
stress fiber assembly - Gene Ontology Molecular Function:
- extracellular matrix binding
extracellular matrix constituent conferring elasticity - Gene Ontology Cellular Component:
- elastic fiber
extracellular space
mitochondrion
proteinaceous extracellular matrix - Keywords:
- Complete proteome
Proteomics identification
Reference proteome
Signal
Publication
- PubMed ID:
- 12853948