Names & Taxonomy

Uniprot ID:
C9J020
Entry Name:
C9J020_HUMAN
Status:
unreviewed
Protein Names:
Solute carrier organic anion transporter family member 6A1
Gene Names:
SLCO6A1
Gene Names Primary:
SLCO6A1
Organism:
Homo sapiens (Human)

Structure

Length:
466
Sequence:
MFVGVARHSGSQDEVSRGVEPLEAARAQPAKDRRAKGTPKSSKPGKKHRYLRLLPEALIRFGGFRKRKKAKSSVSKKPGEVDDSLEQPCGLGCLVSTCCECCNNIRCFMIFYCILLICQGVVFGLIDVSIGDFQKEYQLKTIEKLALEKSYDISSGLVAIFIAFYGDRKKVIWFVASSFLIGLGSLLCAFPSINEENKQSKVGIEGIAECTSMIGYALGYVLGAPLVKVPENTTSATKTGKLGNLTAPCNEKCRCSSSIYSSICGRDDIEYFSPCFAGCTYSKAQNQKKMYYNCSCIKEGLITADAEGDFIDARPGKCDAKCYKLPLFIAFIFSTLIFSGFSGVPIVLAMTRVVPDKLRSLALGVSYVILRIFGTIPGPSIFKMSGETSCILRDVNKCGHTGRCWIYNKTKMAFLLVGICFLCKLCTIIFTTIAFFIYKRRLNENTDFPDVTVKNPKVKKKEETDL
Proteomes:
UP000005640

Function

Gene Ontology Go:
integral component of membrane
transporter activity
Gene Ontology Molecular Function:
transporter activity
Gene Ontology Cellular Component:
integral component of membrane
Keywords:
Complete proteome
Membrane
Reference proteome
Transmembrane
Transmembrane helix

Publication

PubMed ID:
15372022