Names & Taxonomy
- Uniprot ID:
- C1KDE8
- Entry Name:
- C1KDE8_HUMAN
- Status:
- unreviewed
- Protein Names:
- Cytochrome P450 (Fragment)
- Gene Names:
- CYP1B1
- Gene Names Primary:
- CYP1B1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 154
- Sequence:
- RPLTVVAVANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSLVDVMPWLQYFPNPVRTVFREFEQLNRNFSNFILDKFLRHCESLRPGAAPRDMMDAFILSAEKKAAGDSHGGGARLDLENVPATITDIFDASQDTLSTALQWLLLLFT
Function
- Gene Ontology Go:
- heme binding
iron ion binding
monooxygenase activity
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
retinol metabolic process
steroid metabolic process
xenobiotic metabolic process - Gene Ontology Biological Process:
- retinol metabolic process
steroid metabolic process
xenobiotic metabolic process - Gene Ontology Molecular Function:
- heme binding
iron ion binding
monooxygenase activity
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
Publication
- PubMed ID:
- 19536304