Names & Taxonomy
- Uniprot ID:
- A8K9L3
- Entry Name:
- A8K9L3_HUMAN
- Status:
- unreviewed
- Protein Names:
- Proteolipid protein 1 (Pelizaeus-Merzbacher disease, spastic paraplegia 2, uncomplicated), isoform CRA_b (Proteolipid protein 1 isoform 2) (cDNA FLJ77822, highly similar to Homo sapiens proteolipid protein 1 (Pelizaeus-Merzbacher disease,spastic paraplegia 2, uncomplicated) (PLP1), mRNA) (cDNA, FLJ92659, highly similar to Homo sapiens proteolipid protein 1 (Pelizaeus-Merzbacher disease,spastic paraplegia 2, uncomplicated) (PLP1), mRNA)
- Gene Names:
- PLP1 hCG_17970
- Gene Names Orf:
- hCG_17970
- Gene Names Primary:
- PLP1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 277
- Sequence:
- MGLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGITYALTVVWLLVFACSAVPVYIYFNTWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFHLFIAAFVGAAATLVSLLTFMIAATYNFAVLKLMGRGTKF
Function
- Gene Ontology Go:
- integral component of membrane
myelin sheath
structural constituent of myelin sheath
astrocyte development
axon development
cell maturation
central nervous system myelination
inflammatory response
integrin-mediated signaling pathway
long-chain fatty acid biosynthetic process
positive regulation of gene expression - Gene Ontology Biological Process:
- astrocyte development
axon development
cell maturation
central nervous system myelination
inflammatory response
integrin-mediated signaling pathway
long-chain fatty acid biosynthetic process
positive regulation of gene expression - Gene Ontology Molecular Function:
- structural constituent of myelin sheath
- Gene Ontology Cellular Component:
- integral component of membrane
myelin sheath - Keywords:
- Membrane
Transmembrane
Transmembrane helix
Publication
- PubMed ID:
- 11181995