Names & Taxonomy

Uniprot ID:
A0A024R3C5
Entry Name:
A0A024R3C5_HUMAN
Status:
unreviewed
Protein Names:
Dopamine receptor D2, isoform CRA_c
Gene Names:
DRD2 hCG_39593
Gene Names Orf:
hCG_39593
Gene Names Primary:
DRD2
Organism:
Homo sapiens (Human)

Structure

Length:
443
Sequence:
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC

Function

Gene Ontology Go:
acrosomal vesicle
axon terminus
cytosol
dendritic spine
endocytic vesicle
integral component of plasma membrane
lateral plasma membrane
perikaryon
postsynaptic density
sperm flagellum
synaptic vesicle membrane
dopamine binding
dopamine neurotransmitter receptor activity, coupled via Gi/Go
drug binding
acid secretion
activation of protein kinase activity
adenohypophysis development
adenylate cyclase-inhibiting dopamine receptor signaling pathway
adult walking behavior
auditory behavior
axonogenesis
behavioral response to cocaine
behavioral response to ethanol
branching morphogenesis of a nerve
cerebral cortex GABAergic interneuron migration
circadian regulation of gene expression
dopamine metabolic process
feeding behavior
G-protein coupled receptor internalization
grooming behavior
long-term memory
negative regulation of adenylate cyclase activity
negative regulation of blood pressure
negative regulation of cell migration
negative regulation of cell proliferation
negative regulation of circadian sleep/wake cycle, sleep
negative regulation of cytosolic calcium ion concentration
negative regulation of dopamine receptor signaling pathway
negative regulation of dopamine secretion
negative regulation of innate immune response
negative regulation of insulin secretion
negative regulation of protein kinase B signaling
negative regulation of synaptic transmission, glutamatergic
negative regulation of voltage-gated calcium channel activity
neurological system process involved in regulation of systemic arterial blood pressure
orbitofrontal cortex development
peristalsis
phosphatidylinositol metabolic process
phospholipase C-activating dopamine receptor signaling pathway
pigmentation
positive regulation of dopamine uptake involved in synaptic transmission
positive regulation of ERK1 and ERK2 cascade
positive regulation of G-protein coupled receptor protein signaling pathway
positive regulation of growth hormone secretion
positive regulation of long-term synaptic potentiation
positive regulation of multicellular organism growth
positive regulation of neuroblast proliferation
positive regulation of receptor internalization
positive regulation of renal sodium excretion
positive regulation of transcription from RNA polymerase II promoter
positive regulation of urine volume
prepulse inhibition
protein localization
regulation of heart rate
regulation of locomotion involved in locomotory behavior
regulation of long-term neuronal synaptic plasticity
regulation of phosphoprotein phosphatase activity
regulation of potassium ion transport
regulation of sodium ion transport
regulation of synapse structural plasticity
regulation of synaptic transmission, GABAergic
release of sequestered calcium ion into cytosol
response to amphetamine
response to axon injury
response to drug
response to hypoxia
response to inactivity
response to iron ion
response to morphine
response to nicotine
response to toxic substance
sensory perception of smell
striatum development
synapse assembly
synaptic transmission, dopaminergic
temperature homeostasis
visual learning
Wnt signaling pathway
Gene Ontology Biological Process:
acid secretion
activation of protein kinase activity
adenohypophysis development
adenylate cyclase-inhibiting dopamine receptor signaling pathway
adult walking behavior
auditory behavior
axonogenesis
behavioral response to cocaine
behavioral response to ethanol
branching morphogenesis of a nerve
cerebral cortex GABAergic interneuron migration
circadian regulation of gene expression
dopamine metabolic process
feeding behavior
G-protein coupled receptor internalization
grooming behavior
long-term memory
negative regulation of adenylate cyclase activity
negative regulation of blood pressure
negative regulation of cell migration
negative regulation of cell proliferation
negative regulation of circadian sleep/wake cycle, sleep
negative regulation of cytosolic calcium ion concentration
negative regulation of dopamine receptor signaling pathway
negative regulation of dopamine secretion
negative regulation of innate immune response
negative regulation of insulin secretion
negative regulation of protein kinase B signaling
negative regulation of synaptic transmission, glutamatergic
negative regulation of voltage-gated calcium channel activity
neurological system process involved in regulation of systemic arterial blood pressure
orbitofrontal cortex development
peristalsis
phosphatidylinositol metabolic process
phospholipase C-activating dopamine receptor signaling pathway
pigmentation
positive regulation of dopamine uptake involved in synaptic transmission
positive regulation of ERK1 and ERK2 cascade
positive regulation of G-protein coupled receptor protein signaling pathway
positive regulation of growth hormone secretion
positive regulation of long-term synaptic potentiation
positive regulation of multicellular organism growth
positive regulation of neuroblast proliferation
positive regulation of receptor internalization
positive regulation of renal sodium excretion
positive regulation of transcription from RNA polymerase II promoter
positive regulation of urine volume
prepulse inhibition
protein localization
regulation of heart rate
regulation of locomotion involved in locomotory behavior
regulation of long-term neuronal synaptic plasticity
regulation of phosphoprotein phosphatase activity
regulation of potassium ion transport
regulation of sodium ion transport
regulation of synapse structural plasticity
regulation of synaptic transmission, GABAergic
release of sequestered calcium ion into cytosol
response to amphetamine
response to axon injury
response to drug
response to hypoxia
response to inactivity
response to iron ion
response to morphine
response to nicotine
response to toxic substance
sensory perception of smell
striatum development
synapse assembly
synaptic transmission, dopaminergic
temperature homeostasis
visual learning
Wnt signaling pathway
Gene Ontology Molecular Function:
dopamine binding
dopamine neurotransmitter receptor activity, coupled via Gi/Go
drug binding
Gene Ontology Cellular Component:
acrosomal vesicle
axon terminus
cytosol
dendritic spine
endocytic vesicle
integral component of plasma membrane
lateral plasma membrane
perikaryon
postsynaptic density
sperm flagellum
synaptic vesicle membrane
Keywords:
G-protein coupled receptor
Membrane
Receptor
Transducer
Transmembrane
Transmembrane helix

Publication

PubMed ID:
11181995