Names & Taxonomy

Uniprot ID:
W0G8I2
Entry Name:
W0G8I2_HUMAN
Status:
unreviewed
Protein Names:
MHC class II antigen (Fragment)
Gene Names:
HLA-DQB1
Gene Names Primary:
HLA-DQB1
Organism:
Homo sapiens (Human)

Structure

Length:
183
Sequence:
DFVYQFKAMCYFTNGTERVRYVTRYIYNREEYVRFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEW

Function

Gene Ontology Go:
integral component of membrane
MHC class II protein complex
antigen processing and presentation of peptide or polysaccharide antigen via MHC class II
immune response
Gene Ontology Biological Process:
antigen processing and presentation of peptide or polysaccharide antigen via MHC class II
immune response
Gene Ontology Cellular Component:
integral component of membrane
MHC class II protein complex
Keywords:
Disulfide bond
Immunity
MHC II
Membrane
Transmembrane
Transmembrane helix