Names & Taxonomy
- Uniprot ID:
- S5TLS4
- Entry Name:
- S5TLS4_HUMAN
- Status:
- unreviewed
- Protein Names:
- Cannabinoid receptor 1 (Brain)
- Gene Names:
- CNR1
- Gene Names Primary:
- CNR1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 472
- Sequence:
- MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
Function
- Gene Ontology Go:
- axon
growth cone
integral component of membrane
intracellular membrane-bounded organelle
membrane raft
cannabinoid receptor activity
drug binding
aging
axonal fasciculation
glucose homeostasis
maternal process involved in female pregnancy
memory
negative regulation of action potential
negative regulation of blood pressure
negative regulation of dopamine secretion
negative regulation of fatty acid beta-oxidation
negative regulation of mast cell activation
negative regulation of nitric-oxide synthase activity
positive regulation of acute inflammatory response to antigenic stimulus
positive regulation of apoptotic process
positive regulation of blood pressure
positive regulation of fever generation
positive regulation of neuron projection development
regulation of feeding behavior
regulation of insulin secretion
regulation of penile erection
regulation of synaptic transmission, GABAergic
regulation of synaptic transmission, glutamatergic
response to cocaine
response to ethanol
response to lipopolysaccharide
response to morphine
response to nicotine
response to nutrient
sensory perception of pain
spermatogenesis - Gene Ontology Biological Process:
- aging
axonal fasciculation
glucose homeostasis
maternal process involved in female pregnancy
memory
negative regulation of action potential
negative regulation of blood pressure
negative regulation of dopamine secretion
negative regulation of fatty acid beta-oxidation
negative regulation of mast cell activation
negative regulation of nitric-oxide synthase activity
positive regulation of acute inflammatory response to antigenic stimulus
positive regulation of apoptotic process
positive regulation of blood pressure
positive regulation of fever generation
positive regulation of neuron projection development
regulation of feeding behavior
regulation of insulin secretion
regulation of penile erection
regulation of synaptic transmission, GABAergic
regulation of synaptic transmission, glutamatergic
response to cocaine
response to ethanol
response to lipopolysaccharide
response to morphine
response to nicotine
response to nutrient
sensory perception of pain
spermatogenesis - Gene Ontology Molecular Function:
- cannabinoid receptor activity
drug binding - Gene Ontology Cellular Component:
- axon
growth cone
integral component of membrane
intracellular membrane-bounded organelle
membrane raft - Keywords:
- G-protein coupled receptor
Membrane
Receptor
Transducer
Transmembrane
Transmembrane helix