Names & Taxonomy
- Uniprot ID:
- Q9Y691
- Entry Name:
- KCMB2_HUMAN
- Status:
- reviewed
- Protein Names:
- Calcium-activated potassium channel subunit beta-2 (BK channel subunit beta-2) (BKbeta2) (Hbeta2) (Calcium-activated potassium channel, subfamily M subunit beta-2) (Charybdotoxin receptor subunit beta-2) (Hbeta3) (K(VCA)beta-2) (Maxi K channel subunit beta-2) (Slo-beta-2)
- Gene Names:
- KCNMB2
- Gene Names Primary:
- KCNMB2
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 235
- Sequence:
- MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGEDRAILLGLAMMVCSIMMYFLLGITLLRSYMQSVWTEESQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGEKLLLYHTEETIKINQKCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKSVILTKLYSSNVLFHSLFWPTCMMAGGVAIVAMVKLTQYLSLLCERIQRINR
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Membrane; Multi-pass membrane protein.
Function
- Function:
- Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Acts as a negative regulator that confers rapid and complete inactivation of KCNMA1 channel complex. May participate in KCNMA1 inactivation in chromaffin cells of the adrenal gland or in hippocampal CA1 neurons.
- Cross Reference Drug Bank:
- DB01110 DB00721
- Gene Ontology Go:
- integral component of plasma membrane
plasma membrane
voltage-gated potassium channel complex
calcium-activated potassium channel activity
ion channel inhibitor activity
potassium channel regulator activity
action potential
blood coagulation
detection of calcium ion
neuronal action potential
potassium ion transmembrane transport
potassium ion transport
regulation of vasoconstriction
synaptic transmission - Gene Ontology Biological Process:
- action potential
blood coagulation
detection of calcium ion
neuronal action potential
potassium ion transmembrane transport
potassium ion transport
regulation of vasoconstriction
synaptic transmission - Gene Ontology Molecular Function:
- calcium-activated potassium channel activity
ion channel inhibitor activity
potassium channel regulator activity - Gene Ontology Cellular Component:
- integral component of plasma membrane
plasma membrane
voltage-gated potassium channel complex - Keywords:
- 3D-structure
Complete proteome
Glycoprotein
Ion channel
Ion transport
Membrane
Reference proteome
Transmembrane
Transmembrane helix
Transport