Names & Taxonomy
- Uniprot ID:
- Q9UNX3
- Entry Name:
- RL26L_HUMAN
- Status:
- reviewed
- Protein Names:
- 60S ribosomal protein L26-like 1
- Gene Names:
- RPL26L1 RPL26P1
- Gene Names Primary:
- RPL26L1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 145
- Sequence:
- MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEELIEKMQE
- Proteomes:
- UP000005640
Function
- Gene Ontology Go:
- cytosol
cytosolic large ribosomal subunit
extracellular exosome
structural constituent of ribosome
cellular nitrogen compound metabolic process
cellular protein metabolic process
cytoplasmic translation
gene expression
nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
ribosomal large subunit biogenesis
selenium compound metabolic process
selenocysteine metabolic process
small molecule metabolic process
SRP-dependent cotranslational protein targeting to membrane
translation
translational elongation
translational initiation
translational termination
viral life cycle
viral process
viral transcription - Gene Ontology Biological Process:
- cellular nitrogen compound metabolic process
cellular protein metabolic process
cytoplasmic translation
gene expression
nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
ribosomal large subunit biogenesis
selenium compound metabolic process
selenocysteine metabolic process
small molecule metabolic process
SRP-dependent cotranslational protein targeting to membrane
translation
translational elongation
translational initiation
translational termination
viral life cycle
viral process
viral transcription - Gene Ontology Molecular Function:
- structural constituent of ribosome
- Gene Ontology Cellular Component:
- cytosol
cytosolic large ribosomal subunit
extracellular exosome - Keywords:
- Complete proteome
Direct protein sequencing
Isopeptide bond
Reference proteome
Ribonucleoprotein
Ribosomal protein
Ubl conjugation