Names & Taxonomy
- Uniprot ID:
- Q9BXJ5
- Entry Name:
- C1QT2_HUMAN
- Status:
- reviewed
- Protein Names:
- Complement C1q tumor necrosis factor-related protein 2
- Gene Names:
- C1QTNF2 CTRP2 UNQ6349/PRO21054
- Gene Names Orf:
- UNQ6349/PRO21054
- Gene Names Primary:
- C1QTNF2
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 285
- Sequence:
- MIPWVLLACALPCAADPLLGAFARRDFRKGSPQLVCSLPGPQGPPGPPGAPGPSGMMGRMGFPGKDGQDGHDGDRGDSGEEGPPGRTGNRGKPGPKGKAGAIGRAGPRGPKGVNGTPGKHGTPGKKGPKGKKGEPGLPGPCSCGSGHTKSAFSVAVTKSYPRERLPIKFDKILMNEGGHYNASSGKFVCGVPGIYYFTYDITLANKHLAIGLVHNGQYRIRTFDANTGNHDVASGSTILALKQGDEVWLQIFYSEQNGLFYDPYWTDSLFTGFLIYADQDDPNEV
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted
Function
- Gene Ontology Go:
- collagen trimer
extracellular space
activation of MAPK activity
positive regulation of fatty acid oxidation
positive regulation of glucose import
positive regulation of glycogen biosynthetic process
protein heterotrimerization
protein homooligomerization - Gene Ontology Biological Process:
- activation of MAPK activity
positive regulation of fatty acid oxidation
positive regulation of glucose import
positive regulation of glycogen biosynthetic process
protein heterotrimerization
protein homooligomerization - Gene Ontology Cellular Component:
- collagen trimer
extracellular space - Keywords:
- Collagen
Complete proteome
Reference proteome
Secreted
Signal - Interacts With:
- P37235; Q53G59; P61601; Q9BYV2; Q9UMX0-2