Names & Taxonomy
- Uniprot ID:
- Q99720
- Entry Name:
- SGMR1_HUMAN
- Status:
- reviewed
- Protein Names:
- Sigma non-opioid intracellular receptor 1 (Aging-associated gene 8 protein) (SR31747-binding protein) (SR-BP) (Sigma 1-type opioid receptor) (SIG-1R) (Sigma1-receptor) (Sigma1R) (hSigmaR1)
- Gene Names:
- SIGMAR1 OPRS1 SRBP AAG8
- Gene Names Orf:
- AAG8
- Gene Names Primary:
- SIGMAR1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 223
- Sequence:
- MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Nucleus inner membrane. Nucleus outer membrane. Endoplasmic reticulum membrane. Lipid droplet. Cell junction. Cell membrane. Cell projection, growth cone. Cell junction, synapse, postsynaptic cell membrane, postsynaptic density
Function
- Function:
- Functions in lipid transport from the endoplasmic reticulum and is involved in a wide array of cellular functions probably through regulation of the biogenesis of lipid microdomains at the plasma membrane. Involved in the regulation of different receptors it plays a role in BDNF signaling and EGF signaling. Also regulates ion channels like the potassium channel and could modulate neurotransmitter release. Plays a role in calcium signaling through modulation together with ANK2 of the ITP3R-dependent calcium efflux at the endoplasmic reticulum. Plays a role in several other cell functions including proliferation, survival and death. Originally identified for its ability to bind various psychoactive drugs it is involved in learning processes, memory and mood alteration (PubMed:16472803, PubMed:9341151). Necessary for proper mitochondrial axonal transport in motor neurons, in particular the retrograde movement of mitochondria (By similarity).
- Cross Reference Drug Bank:
- DB00321 DB09014 DB00514 DB00540 DB00652 DB00409
- Gene Ontology Go:
- cell junction
endoplasmic reticulum membrane
growth cone
integral component of membrane
integral component of plasma membrane
lipid particle
neuronal postsynaptic density
nuclear envelope
nuclear inner membrane
nuclear outer membrane
postsynaptic membrane
drug binding
opioid receptor activity
lipid transport
nervous system development
regulation of neuron apoptotic process - Gene Ontology Biological Process:
- lipid transport
nervous system development
regulation of neuron apoptotic process - Gene Ontology Molecular Function:
- drug binding
opioid receptor activity - Gene Ontology Cellular Component:
- cell junction
endoplasmic reticulum membrane
growth cone
integral component of membrane
integral component of plasma membrane
lipid particle
neuronal postsynaptic density
nuclear envelope
nuclear inner membrane
nuclear outer membrane
postsynaptic membrane - Keywords:
- Alternative splicing
Amyotrophic lateral sclerosis
Cell junction
Cell membrane
Cell projection
Complete proteome
Direct protein sequencing
Disease mutation
Endoplasmic reticulum
Lipid droplet
Lipid transport
Membrane
Neurodegeneration
Nucleus
Polymorphism
Postsynaptic cell membrane
Receptor
Reference proteome
Synapse
Transmembrane
Transmembrane helix
Transport