Names & Taxonomy
- Uniprot ID:
- Q96BI3
- Entry Name:
- APH1A_HUMAN
- Status:
- reviewed
- Protein Names:
- Gamma-secretase subunit APH-1A (APH-1a) (Aph-1alpha) (Presenilin-stabilization factor)
- Gene Names:
- APH1A PSF CGI-78 UNQ579/PRO1141
- Gene Names Orf:
- CGI-78 UNQ579/PRO1141
- Gene Names Primary:
- APH1A
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 265
- Sequence:
- MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQRSLLCRRQEDSRVMVYSALRIPPED
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus, Golgi stack membrane; Multi-pass membrane protein. Note=Predominantly located in the endoplasmic reticulum and in the cis-Golgi.
Function
- Function:
- Essential subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral proteins such as Notch receptors and APP (beta-amyloid precursor protein). It probably represents a stabilizing cofactor for the presenilin homodimer that promotes the formation of a stable complex.
- Gene Ontology Go:
- endoplasmic reticulum
endoplasmic reticulum membrane
Golgi apparatus
Golgi cisterna membrane
integral component of plasma membrane
membrane
plasma membrane
endopeptidase activity
amyloid precursor protein catabolic process
apoptotic signaling pathway
axon guidance
ephrin receptor signaling pathway
membrane protein ectodomain proteolysis
membrane protein intracellular domain proteolysis
metanephros development
neurotrophin TRK receptor signaling pathway
Notch receptor processing
Notch signaling pathway
positive regulation of apoptotic process
positive regulation of catalytic activity
protein processing - Gene Ontology Biological Process:
- amyloid precursor protein catabolic process
apoptotic signaling pathway
axon guidance
ephrin receptor signaling pathway
membrane protein ectodomain proteolysis
membrane protein intracellular domain proteolysis
metanephros development
neurotrophin TRK receptor signaling pathway
Notch receptor processing
Notch signaling pathway
positive regulation of apoptotic process
positive regulation of catalytic activity
protein processing - Gene Ontology Molecular Function:
- endopeptidase activity
- Gene Ontology Cellular Component:
- endoplasmic reticulum
endoplasmic reticulum membrane
Golgi apparatus
Golgi cisterna membrane
integral component of plasma membrane
membrane
plasma membrane - Keywords:
- 3D-structure
Alternative splicing
Complete proteome
Endoplasmic reticulum
Golgi apparatus
Membrane
Notch signaling pathway
Reference proteome
Transmembrane
Transmembrane helix - Interacts With:
- Q92542