Names & Taxonomy
- Uniprot ID:
- Q95460
- Entry Name:
- HMR1_HUMAN
- Status:
- reviewed
- Protein Names:
- Major histocompatibility complex class I-related gene protein (MHC class I-related gene protein) (Class I histocompatibility antigen-like protein)
- Gene Names:
- MR1
- Gene Names Primary:
- MR1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 341
- Sequence:
- MGELMAFLLPLIIVLMVKHSDSRTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWMAENLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNHSGSHTYQRMIGCELLEDGSTTGFLQYAYDGQDFLIFNKDTLSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYGDILPSGDGTYQAWASIELDPQSSNLYSCHVEHCGVHMVLQVPQESETIPLVMKAVSGSIVLVIVLAGVGVLVWRRRPREQNGAIYLPTPDR
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cell membrane; Single-pass membrane protein; Extracellular side. Endoplasmic reticulum.; Isoform 4: Secreted.; Isoform 3: Cell membrane
Function
- Function:
- Antigen-presenting molecule specialized in presenting microbial vitamin B metabolites. Involved in the development and expansion of a small population of T-cells expressing an invariant T-cell receptor alpha chain called mucosal-associated invariant T-cells (MAIT). MAIT lymphocytes are preferentially located in the gut lamina propria and therefore may be involved in monitoring commensal flora or serve as a distress signal. Expression and MAIT cell recognition seem to be ligand-dependent.
- Cross Reference Drug Bank:
- DB00098
- Gene Ontology Go:
- endoplasmic reticulum
endoplasmic reticulum membrane
extracellular region
integral component of membrane
MHC class I protein complex
plasma membrane
antigen binding
MHC class I receptor activity
peptide antigen binding
antigen processing and presentation
antigen processing and presentation of peptide antigen via MHC class I
cytokine production involved in immune response
defense response to Gram-negative bacterium
immune response
innate immune response
interleukin-1 beta production
interleukin-17 production
signal transduction - Gene Ontology Biological Process:
- antigen processing and presentation
antigen processing and presentation of peptide antigen via MHC class I
cytokine production involved in immune response
defense response to Gram-negative bacterium
immune response
innate immune response
interleukin-17 production
interleukin-1 beta production
signal transduction - Gene Ontology Molecular Function:
- antigen binding
MHC class I receptor activity
peptide antigen binding - Gene Ontology Cellular Component:
- endoplasmic reticulum
endoplasmic reticulum membrane
extracellular region
integral component of membrane
MHC class I protein complex
plasma membrane - Keywords:
- 3D-structure
Alternative splicing
Cell membrane
Complete proteome
Disulfide bond
Endoplasmic reticulum
Glycoprotein
Immunity
Immunoglobulin domain
Innate immunity
MHC I
Membrane
Polymorphism
Reference proteome
Secreted
Signal
Transmembrane
Transmembrane helix - Interacts With:
- Q969F0