Names & Taxonomy

Uniprot ID:
A2J1N8
Entry Name:
A2J1N8_HUMAN
Status:
unreviewed
Protein Names:
Rheumatoid factor RF-ET11 (Fragment)
Organism:
Homo sapiens (Human)

Structure

Length:
95
Sequence:
ESGGGLVQPGGSLKLSCAASGFTFSGSAMHWVRQGSGKGLEWVGRIKNKADSYATAYAAAVKDRFTISRDDSKNTAYLQMKSLKTEDTAVYYCTR

Publication

PubMed ID:
9464528