Drug Miner Browse

Names & Taxonomy

Uniprot ID:: Q92769
Entry Name:: HDAC2_HUMAN
Status:: reviewed
Protein Names:: Histone deacetylase 2 (HD2) (EC 3.5.1.98)
Gene Names:: HDAC2
Gene Names Primary:: HDAC2
Organism:: Homo sapiens (Human)

Structure

Length:: 488
Sequence:: MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP
Proteomes:: UP000005640

Subcellular location

Subcellular Location:: Nucleus

Function

Function:: Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Forms transcriptional repressor complexes by associating with MAD, SIN3, YY1 and N-COR. Interacts in the late S-phase of DNA-replication with DNMT1 in the other transcriptional repressor complex composed of DNMT1, DMAP1, PCNA, CAF1. Deacetylates TSHZ3 and regulates its transcriptional repressor activity. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. May be involved in the transcriptional repression of circadian target genes, such as PER1, mediated by CRY1 through histone deacetylation. Involved in MTA1-mediated transcriptional corepression of TFF1 and CDKN1A.
Catalytic Activity:: Hydrolysis of an N(6)-acetyl-lysine residue of a histone to yield a deacetylated histone.
Active Site:: ACT_SITE 142 142
Cross Reference Drug Bank:: DB01223 DB00227 DB01303 DB06603 DB00277 DB00313 DB02546
Gene Ontology Go:: cytoplasm
ESC/E(Z) complex
nuclear chromatin
nucleoplasm
nucleus
NuRD complex
protein complex
Sin3 complex
chromatin binding
core promoter binding
deacetylase activity
enzyme binding
histone deacetylase activity
NAD-dependent histone deacetylase activity (H3-K14 specific)
NF-kappaB binding
poly(A) RNA binding
protein deacetylase activity
RNA polymerase II repressing transcription factor binding
sequence-specific DNA binding
transcription factor binding
ATP-dependent chromatin remodeling
behavioral response to ethanol
blood coagulation
cardiac muscle hypertrophy
cellular response to dopamine
cellular response to heat
cellular response to hydrogen peroxide
cellular response to retinoic acid
cellular response to transforming growth factor beta stimulus
chromatin organization
chromatin remodeling
circadian regulation of gene expression
dendrite development
embryonic digit morphogenesis
epidermal cell differentiation
eyelid development in camera-type eye
fungiform papilla formation
gene expression
hair follicle placode formation
histone deacetylation
histone H3 deacetylation
histone H4 deacetylation
maintenance of chromatin silencing
negative regulation of apoptotic process
negative regulation of cell cycle
negative regulation of dendritic spine development
negative regulation of DNA binding
negative regulation of gene expression, epigenetic
negative regulation of MHC class II biosynthetic process
negative regulation of neuron projection development
negative regulation of peptidyl-lysine acetylation
negative regulation of sequence-specific DNA binding transcription factor activity
negative regulation of transcription from RNA polymerase II promoter
negative regulation of transcription, DNA-templated
neurotrophin TRK receptor signaling pathway
odontogenesis of dentin-containing tooth
positive regulation of cell proliferation
positive regulation of collagen biosynthetic process
positive regulation of epithelial to mesenchymal transition
positive regulation of interleukin-1 production
positive regulation of oligodendrocyte differentiation
positive regulation of proteolysis
positive regulation of receptor biosynthetic process
positive regulation of transcription from RNA polymerase II promoter
positive regulation of transcription, DNA-templated
positive regulation of tumor necrosis factor production
positive regulation of tyrosine phosphorylation of Stat3 protein
regulation of gene expression, epigenetic
response to amphetamine
response to caffeine
response to cocaine
response to drug
response to hyperoxia
response to lipopolysaccharide
response to nicotine
transcription, DNA-templated
Gene Ontology Biological Process:: ATP-dependent chromatin remodeling
behavioral response to ethanol
blood coagulation
cardiac muscle hypertrophy
cellular response to dopamine
cellular response to heat
cellular response to hydrogen peroxide
cellular response to retinoic acid
cellular response to transforming growth factor beta stimulus
chromatin organization
chromatin remodeling
circadian regulation of gene expression
dendrite development
embryonic digit morphogenesis
epidermal cell differentiation
eyelid development in camera-type eye
fungiform papilla formation
gene expression
hair follicle placode formation
histone deacetylation
histone H3 deacetylation
histone H4 deacetylation
maintenance of chromatin silencing
negative regulation of apoptotic process
negative regulation of cell cycle
negative regulation of dendritic spine development
negative regulation of DNA binding
negative regulation of gene expression, epigenetic
negative regulation of MHC class II biosynthetic process
negative regulation of neuron projection development
negative regulation of peptidyl-lysine acetylation
negative regulation of sequence-specific DNA binding transcription factor activity
negative regulation of transcription, DNA-templated
negative regulation of transcription from RNA polymerase II promoter
neurotrophin TRK receptor signaling pathway
odontogenesis of dentin-containing tooth
positive regulation of cell proliferation
positive regulation of collagen biosynthetic process
positive regulation of epithelial to mesenchymal transition
positive regulation of interleukin-1 production
positive regulation of oligodendrocyte differentiation
positive regulation of proteolysis
positive regulation of receptor biosynthetic process
positive regulation of transcription, DNA-templated
positive regulation of transcription from RNA polymerase II promoter
positive regulation of tumor necrosis factor production
positive regulation of tyrosine phosphorylation of Stat3 protein
regulation of gene expression, epigenetic
response to amphetamine
response to caffeine
response to cocaine
response to drug
response to hyperoxia
response to lipopolysaccharide
response to nicotine
transcription, DNA-templated
Gene Ontology Molecular Function:: chromatin binding
core promoter binding
deacetylase activity
enzyme binding
histone deacetylase activity
NAD-dependent histone deacetylase activity (H3-K14 specific)
NF-kappaB binding
poly(A) RNA binding
protein deacetylase activity
RNA polymerase II repressing transcription factor binding
sequence-specific DNA binding
transcription factor binding
Gene Ontology Cellular Component:: cytoplasm
ESC/E(Z) complex
nuclear chromatin
nucleoplasm
nucleus
NuRD complex
protein complex
Sin3 complex
Keywords:: 3D-structure
Acetylation
Alternative splicing
Biological rhythms
Chromatin regulator
Complete proteome
Cytoplasm
Hydrolase
Isopeptide bond
Nucleus
Phosphoprotein
Polymorphism
Reference proteome
Repressor
S-nitrosylation
Transcription
Transcription regulation
Ubl conjugation
Interacts With:: Q9C0K0; Q9HCU9; Q9UER7; P51610; Q13547; Q2HR82; Q9UIS9; Q13330; P01106; P06748; P48382; Q96ST3; O95863; Q9HD15; O43463

Names & Taxonomy

Structure

Subcellular location

Function

Publication