Names & Taxonomy
- Uniprot ID:
- Q86UW2
- Entry Name:
- OSTB_HUMAN
- Status:
- reviewed
- Protein Names:
- Organic solute transporter subunit beta (OST-beta) (Solute carrier family 51 subunit beta)
- Gene Names:
- SLC51B OSTB
- Gene Names Primary:
- SLC51B
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 128
- Sequence:
- MEHSEGAPGDPAGTVVPQELLEEMLWFFRVEDASPWNHSILALAAVVVIISMVLLGRSIQASRKEKMQPPEKETPEVLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPETES
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cell membrane
Function
- Function:
- Essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood. Efficiently transports the major species of bile acids. Modulates SLC51A glycosylation, membrane trafficking and stability activities.
- Cross Reference Drug Bank:
- DB00286 DB00390 DB00917
- Gene Ontology Go:
- integral component of membrane
plasma membrane
protein complex
protein heterodimerization activity
transporter activity
bile acid and bile salt transport
positive regulation of protein exit from endoplasmic reticulum
positive regulation of protein glycosylation
positive regulation of protein targeting to membrane
regulation of protein stability - Gene Ontology Biological Process:
- bile acid and bile salt transport
positive regulation of protein exit from endoplasmic reticulum
positive regulation of protein glycosylation
positive regulation of protein targeting to membrane
regulation of protein stability - Gene Ontology Molecular Function:
- protein heterodimerization activity
transporter activity - Gene Ontology Cellular Component:
- integral component of membrane
plasma membrane
protein complex - Keywords:
- Cell membrane
Complete proteome
Membrane
Reference proteome
Transmembrane
Transmembrane helix
Transport